# VIP (Vasoactive Intestinal Peptide) > A 28-amino-acid neuropeptide and gut hormone with broad anti-inflammatory and vasodilatory activity — studied in chronic inflammatory illness and, as aviptadil, in the lung. - Also known as: Vasoactive Intestinal Peptide, Aviptadil, VIP - Class: Peptide Hormones, Immune - FDA approved: No - Canonical page: https://americanpeptide.com/catalog/vip ## Overview Vasoactive intestinal peptide (VIP) is a 28-residue neuropeptide of the secretin/glucagon/VIP superfamily, released by nerves throughout the gut, lungs, and brain. It is a potent vasodilator and a broad anti-inflammatory and immunomodulatory signal, acting at the VPAC1 and VPAC2 receptors. Its synthetic form, aviptadil, has been investigated for pulmonary conditions, and VIP is used on the grey market as a nasal spray in chronic inflammatory illness protocols. VIP is one of the body’s master anti-inflammatory signals. A 28-amino-acid member of the secretin/glucagon/VIP superfamily — a structural cousin of secretin and PACAP — it is released by nerve endings across the gastrointestinal tract, lungs, and central nervous system, where it relaxes smooth muscle, widens blood vessels, and damps down inflammatory immune activity by shifting cells away from a pro-inflammatory state. That anti-inflammatory breadth is the basis of its research interest. Its synthetic equivalent, aviptadil, has been studied in pulmonary arterial hypertension, sarcoidosis, and acute respiratory failure. Separately, VIP has developed a following in the chronic inflammatory response syndrome (CIRS) community, where an intranasal form is used in the later stages of the mold-illness protocol popularized by Ritchie Shoemaker — a use that is neither FDA-approved nor validated by large trials. VIP is not FDA-approved; its C-terminus is amidated, a modification essential to its receptor activity. ## Mechanism Agonist at the VPAC1 and VPAC2 receptors (class B GPCRs), raising cAMP; produces vasodilation, bronchodilation, and a broad anti-inflammatory / immunomodulatory shift. ## Chemistry | Property | Value | | --- | --- | | Molecular formula | C147H237N43O43S | | Molecular weight | 3326.8 Da | | CAS number | 37221-79-7 | | PubChem CID | [53314964](https://pubchem.ncbi.nlm.nih.gov/compound/53314964) | ## Sequence ``` HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2 ``` ## Research areas Studied in: Chronic inflammatory response syndrome, Anti-inflammatory / immune modulation, Pulmonary arterial hypertension, Sarcoidosis. Guides on this site: - [Immune & Inflammation](https://americanpeptide.com/research-areas/immune-inflammation): Thymic and host-defense peptides studied for immune modulation. ## Key research - Broad anti-inflammatory signal — shifts immune activity away from a pro-inflammatory state via VPAC1 / VPAC2 receptors, a basis for its use in inflammatory conditions. - Vasodilation & lung — a potent vasodilator; the synthetic form aviptadil has been trialed in pulmonary arterial hypertension and acute respiratory failure. - CIRS / mold-illness protocols — an intranasal form is used in the later stages of the Shoemaker CIRS protocol, a grey-market use not validated by large trials. - Secretin/glucagon/VIP family — a structural relative of secretin and PACAP, sharing the class B GPCR template. - Not FDA-approved — investigational; the C-terminal amide is required for activity. ## Storage, handling & synthesis **Synthesis.** VIP is a 28-residue C-terminally amidated neuropeptide of the secretin/glucagon family, made by solid-phase synthesis. The length drives deletion-sequence accumulation and the sequence is aggregation-prone, so coupling efficiency, the C-terminal amidation, and preparative-HPLC purification together define the quality picture. ## FAQs ### What is VIP? Vasoactive intestinal peptide is a 28-amino-acid neuropeptide and gut hormone that dilates blood vessels and broadly damps inflammation, acting at the VPAC1 and VPAC2 receptors. ### What is VIP studied for? Anti-inflammatory and immune modulation, pulmonary conditions (as aviptadil), and — on the grey market — chronic inflammatory response syndrome (CIRS) via an intranasal form. ### What is the CIRS / mold connection? Intranasal VIP is used in the later stages of the Shoemaker CIRS ("mold illness") protocol. This is not an FDA-approved use and is not validated by large controlled trials. ### Is VIP approved? No — VIP (and its synthetic form aviptadil) is investigational, not FDA-approved. This page is a research and educational reference. ## Latest research Recent trials and publications mentioning Vasoactive Intestinal Peptide, pulled automatically from ClinicalTrials.gov and PubMed (unfiltered search results, refreshed daily). ### Recent trials - [TEAS Timing for Gastrectomy Recovery (TEAS-TIME Trial)](https://clinicaltrials.gov/study/NCT07714980) — NOT_YET_RECRUITING · NA · NCT07714980 - [Acupuncture for Postoperative Gastric Emptying Delay](https://clinicaltrials.gov/study/NCT07505927) — RECRUITING · NA · NCT07505927 - [Study on Neostigmine Acupoint Injection at Zusanli(ST36) for Treating Mechanical Ventilation-Associated Gastrointestinal Dysfunction](https://clinicaltrials.gov/study/NCT07692282) — NOT_YET_RECRUITING · NA · NCT07692282 - [Investigation Into Detection of Prostate Cancer Using Voided Urine (Prostate VPAC)](https://clinicaltrials.gov/study/NCT04788277) — ACTIVE_NOT_RECRUITING · NCT04788277 - [Effect of Sacral Nerve Stimulation on Enteric Nervous System](https://clinicaltrials.gov/study/NCT01786304) — COMPLETED · NA · NCT01786304 - [Inhaled ZYESAMI (Aviptadil Acetate) for Treatment of Severe COVID-19](https://clinicaltrials.gov/study/NCT05137795) — WITHDRAWN · PHASE3 · NCT05137795 --- Source: AmericanPeptide.com — https://americanpeptide.com/catalog/vip Data license: CC BY 4.0 (https://creativecommons.org/licenses/by/4.0/). Attribution: AmericanPeptide.com. Research reference only — computational and educational content, not medical advice.