# Exenatide > The first GLP-1 receptor agonist ever approved (Byetta, 2005) — synthetic exendin-4, a 39-residue peptide first isolated from Gila monster venom. - Also known as: Byetta, Bydureon, Exendin-4, AC2993 - Class: Metabolic, Peptide Hormones - FDA approved: Yes - Canonical page: https://americanpeptide.com/catalog/exenatide ## Overview Exenatide is where the GLP-1 drug class began. It is the synthetic form of exendin-4, a 39-amino-acid peptide discovered in the venom of the Gila monster (Heloderma suspectum) that activates the human GLP-1 receptor but resists the enzyme that destroys native GLP-1 in minutes. The FDA approved it as twice-daily Byetta in April 2005 for type 2 diabetes, and as once-weekly Bydureon — the same peptide in slow-release microspheres — in 2012. It has since been overtaken by longer-acting agents, but every later GLP-1 drug descends from its proof of concept. In 1992 the endocrinologist John Eng, screening lizard venoms for bioactive peptides, isolated exendin-4 from the Gila monster. It shares only about half its sequence with human GLP-1, yet it binds and activates the same receptor — and because its second residue is glycine rather than alanine, the enzyme DPP-4 cannot clip it. A two-minute hormone became a peptide with a half-life of about 2.4 hours. Amylin Pharmaceuticals and Eli Lilly developed the synthetic peptide as exenatide. Byetta (twice daily before meals) was approved in 2005 as the first GLP-1 receptor agonist, with modest weight loss noted from the start. The next step was a delivery solution rather than a new molecule: Bydureon encapsulates the unmodified peptide in biodegradable poly(lactide-co-glycolide) microspheres that release it over weeks, allowing once-weekly dosing without acylation or fusion — a formulation approach none of the later blockbusters took. Its outcomes record is mixed, and worth stating plainly. EXSCEL (Holman et al., NEJM 2017) followed 14,752 adults with type 2 diabetes: weekly exenatide was non-inferior to placebo for major cardiovascular events (hazard ratio 0.91, 95% CI 0.83–1.00) but narrowly missed superiority. Interest in GLP-1 agonists for neurodegeneration began with small exenatide trials in Parkinson’s disease, but the Phase 3 Exenatide-PD3 trial (Lancet 2025) found no benefit over 96 weeks. Exenatide is a 39-residue linear peptide with no acylation, which makes it one of the more tractable incretins to synthesize. ## Mechanism GLP-1 receptor agonism → glucose-dependent insulin secretion, glucagon suppression, slowed gastric emptying, increased satiety. A glycine at position 2 (where GLP-1 has alanine) blocks DPP-4 cleavage. ## Chemistry | Property | Value | | --- | --- | | Molecular formula | C184H282N50O60S | | Molecular weight | 4186.6 Da | | CAS number | 141758-74-9 | | PubChem CID | [45588096](https://pubchem.ncbi.nlm.nih.gov/compound/45588096) | ## Sequence ``` HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS ``` ## Research areas Studied in: Type 2 diabetes, Cardiovascular outcomes, Parkinson’s disease, Peptide drug delivery. Guides on this site: - [Weight Loss & Metabolic Health](https://americanpeptide.com/research-areas/weight-loss): Incretin and metabolic peptides studied for glycemic control and fat loss. ## Key research - First in class — approved April 2005 (Byetta) as the first GLP-1 receptor agonist; the proof of concept for the entire incretin drug class. - Natural-product origin — synthetic exendin-4 from Gila monster venom; ~53% sequence identity with human GLP-1, with a Gly2 that confers DPP-4 resistance. - Extended release by formulation — Bydureon uses PLGA microspheres for once-weekly dosing of the unmodified peptide (approved 2012). - Cardiovascular outcomes — EXSCEL (NEJM 2017, n=14,752) showed non-inferiority (HR 0.91) but not superiority for MACE. - Parkinson’s disease — early signals were not confirmed: the Phase 3 Exenatide-PD3 trial (Lancet 2025) reported no benefit at 96 weeks. ## Storage, handling & synthesis **Storage.** Lyophilized reference material: store frozen and protected from light. Reconstituted: refrigerate at 2–8 °C and use promptly. The methionine at position 14 is prone to oxidation. **Handling.** Reconstitute gently — swirl rather than shake. Minimize air exposure and freeze–thaw cycles to limit methionine oxidation. ## FAQs ### What is exenatide? Exenatide is a 39-amino-acid GLP-1 receptor agonist — the synthetic version of exendin-4 — FDA-approved for type 2 diabetes as twice-daily Byetta (2005) and once-weekly Bydureon (2012). It was the first drug in the GLP-1 class. ### Does exenatide really come from Gila monster venom? The peptide it copies does. Exendin-4 was isolated from Gila monster venom in 1992. The drug itself is made by chemical peptide synthesis, not extracted from lizards. ### How is exenatide different from semaglutide? Exenatide is based on a lizard peptide, has a half-life of about 2.4 hours, and reaches weekly dosing only through a slow-release microsphere formulation. Semaglutide is based on human GLP-1 and is acylated so the molecule itself lasts about a week. Semaglutide produces much larger weight and HbA1c reductions. ### Does exenatide cause weight loss? Modestly — typically a few kilograms in diabetes trials. It has no weight-management indication. ### Does exenatide help Parkinson’s disease? Small early trials suggested a possible effect, but the Phase 3 Exenatide-PD3 trial (Lancet 2025) found no benefit over placebo across 96 weeks. It is not approved for any neurological use. ### What are the side effects of exenatide? Nausea is the most common, along with vomiting and diarrhea; the weekly formulation can cause injection-site nodules. Bydureon carries the class boxed warning about thyroid C-cell tumors. This page is a research reference, not medical advice. ## Latest research Recent trials and publications mentioning Exenatide, pulled automatically from ClinicalTrials.gov and PubMed (unfiltered search results, refreshed daily). ### Recent trials - [Targeting Agonists of Glucagon-like Peptide-1 Receptor for Multiple Sclerosis](https://clinicaltrials.gov/study/NCT07497399) — RECRUITING · PHASE2 · NCT07497399 - [Islet Transplantation in Type 1 Diabetic Patients Using the University of Illinois at Chicago (UIC) Protocol](https://clinicaltrials.gov/study/NCT00679042) — COMPLETED · PHASE3 · NCT00679042 - [A Study on the Safety and Clinical Efficacy of Guominkang in the Treatment of Diabetic Kidney Disease](https://clinicaltrials.gov/study/NCT07907965) — ACTIVE_NOT_RECRUITING · PHASE2 · NCT07907965 - [A Real-world Study of Treatment Retention and Adherence to Secukinumab in Patients With Plaque Psoriasis (PsO) With or Without Glucagon-like Peptide-1 Receptor Agonist (GLP-1 RA) Co-therapy](https://clinicaltrials.gov/study/NCT07881783) — NOT_YET_RECRUITING · NCT07881783 - [Effect of Weekly GLP1 Agonist Treatment in "Double Diabetes"](https://clinicaltrials.gov/study/NCT05305794) — RECRUITING · PHASE3 · NCT05305794 - [A Pan-European Post-Authorisation Safety Study: Risk of Pancreatic Cancer Among Type 2 Diabetes Patients Who Initiated Exenatide as Compared With Those Who Initiated Other Non-Glucagon-Like Peptide 1 Receptor Agonists Based Glucose Lowering Drugs](https://clinicaltrials.gov/study/NCT05663515) — RECRUITING · NCT05663515 --- Source: AmericanPeptide.com — https://americanpeptide.com/catalog/exenatide Data license: CC BY 4.0 (https://creativecommons.org/licenses/by/4.0/). Attribution: AmericanPeptide.com. Research reference only — computational and educational content, not medical advice.