{"version":"1.0","license":"CC BY 4.0","attribution":"AmericanPeptide.com","documentation":"https://americanpeptide.com/developers","generated":"2026-08-15T13:28:21.074Z","filters":{"category":null,"area":"weight-loss","fda":true,"q":null},"categories":[{"id":"metabolic","label":"Metabolic"},{"id":"growth-hormone","label":"Growth Hormone"},{"id":"healing-repair","label":"Healing & Repair"},{"id":"cognitive","label":"Cognitive"},{"id":"longevity","label":"Longevity"},{"id":"cosmetic","label":"Cosmetic"},{"id":"reproductive","label":"Reproductive"},{"id":"immune","label":"Immune"},{"id":"mitochondrial","label":"Mitochondrial"},{"id":"bioregulator","label":"Bioregulators"}],"researchAreas":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health"},{"slug":"wound-healing","label":"Wound Healing & Tissue Repair"},{"slug":"cognition-neuroprotection","label":"Cognition & Neuroprotection"},{"slug":"anxiety-mood","label":"Anxiety, Mood & Stress"},{"slug":"sleep-circadian","label":"Sleep & Circadian Rhythm"},{"slug":"longevity-aging","label":"Longevity & Aging"},{"slug":"growth-hormone-axis","label":"Growth Hormone & Body Composition"},{"slug":"skin-hair","label":"Skin & Hair"},{"slug":"sexual-reproductive","label":"Sexual & Reproductive Health"},{"slug":"immune-inflammation","label":"Immune & Inflammation"},{"slug":"mitochondrial","label":"Mitochondrial & Bioenergetics"},{"slug":"bioregulators","label":"Peptide Bioregulators"}],"count":5,"peptides":[{"slug":"semaglutide","name":"Semaglutide","aliases":["Ozempic","Wegovy","Rybelsus"],"categories":["metabolic"],"categoryLabels":["Metabolic"],"researchAreas":["Type 2 diabetes","Obesity","MASH","Cardiovascular risk reduction"],"researchAreaGuides":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health","url":"https://americanpeptide.com/research-areas/weight-loss"}],"shortDescription":"Long-acting GLP-1 receptor agonist for glycemic control and weight management.","description":"Semaglutide is a 31-amino-acid GLP-1 receptor agonist engineered for once-weekly dosing via fatty-acid acylation and amino-acid substitutions that resist DPP-4 degradation. Approved by the FDA for type 2 diabetes (2017) and chronic weight management (2021).","background":["Semaglutide is a glucagon-like peptide-1 (GLP-1) receptor agonist built on the backbone of human GLP-1. Two engineering changes define it: a C18 fatty-diacid chain attached through a linker that promotes reversible binding to albumin, and amino-acid substitutions that resist degradation by the enzyme DPP-4. Together these extend its half-life to roughly a week, enabling once-weekly administration.","It reached the market first for type 2 diabetes (Ozempic, 2017; oral Rybelsus, 2019) and then for chronic weight management (Wegovy, 2021). Large cardiovascular-outcome and weight-management trials have made it one of the most studied metabolic peptides of the past decade, and its template — acylation plus DPP-4 resistance — now informs the broader incretin class."],"keyResearch":["Glycemic control — studied for glucose-dependent insulin secretion and glucagon suppression in type 2 diabetes.","Weight management — chronic-weight-management trials reported substantial mean body-weight reduction versus placebo.","Cardiovascular outcomes — investigated for reduction of major adverse cardiovascular events in at-risk populations.","MASH / hepatic fat — examined as an endpoint in metabolic liver-disease research.","Half-life engineering — fatty-acid acylation and DPP-4-resistant substitutions are the basis of its once-weekly profile."],"faqs":[{"q":"What is semaglutide?","a":"Semaglutide is a long-acting GLP-1 receptor agonist approved for type 2 diabetes and chronic weight management. It is marketed as Ozempic, Wegovy, and Rybelsus."},{"q":"How does semaglutide promote weight loss?","a":"In studies it slows gastric emptying and acts on appetite centers in the brain while enhancing glucose-dependent insulin release, which together reduce caloric intake."},{"q":"Why is it dosed once weekly?","a":"Fatty-acid acylation promotes reversible binding to albumin and amino-acid substitutions resist DPP-4 breakdown, extending its half-life to about a week."},{"q":"What is the difference between Ozempic, Wegovy, and Rybelsus?","a":"All three are semaglutide. Ozempic and oral Rybelsus are approved for type 2 diabetes; Wegovy is approved for chronic weight management. This page is a research reference, not medical advice."}],"mechanism":"GLP-1 receptor agonism → glucose-dependent insulin secretion, slowed gastric emptying, central appetite suppression.","molecularWeight":4113.6,"molecularFormula":"C187H291N45O59","sequence":null,"cas":"910463-68-2","pubchemCid":56843331,"uniprotId":null,"fdaApproved":true,"url":"https://americanpeptide.com/catalog/semaglutide"},{"slug":"tirzepatide","name":"Tirzepatide","aliases":["Mounjaro","Zepbound"],"categories":["metabolic"],"categoryLabels":["Metabolic"],"researchAreas":["Type 2 diabetes","Obesity","Obstructive sleep apnea"],"researchAreaGuides":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health","url":"https://americanpeptide.com/research-areas/weight-loss"},{"slug":"sleep-circadian","label":"Sleep & Circadian Rhythm","url":"https://americanpeptide.com/research-areas/sleep-circadian"}],"shortDescription":"Dual GIP / GLP-1 receptor agonist with industry-leading weight-loss endpoints.","description":"Tirzepatide is a 39-amino-acid synthetic peptide acting as a dual agonist at GIP and GLP-1 receptors. Approved by the FDA for type 2 diabetes (2022) and chronic weight management (2023).","background":["Tirzepatide is a synthetic 39-amino-acid peptide that activates two incretin receptors at once — GIP (glucose-dependent insulinotropic polypeptide) and GLP-1. It carries a fatty-acid chain for albumin binding and once-weekly dosing, and is sometimes described as a \"twincretin\" for its dual mechanism.","Developed by Eli Lilly, it was approved for type 2 diabetes (Mounjaro, 2022) and chronic weight management (Zepbound, 2023). In placebo-controlled and head-to-head trials it produced some of the largest weight reductions reported for a pharmacologic agent, which has driven intense research interest in multi-receptor incretin design."],"keyResearch":["Glycemic control — dual GIP/GLP-1 activation studied for insulin secretion and HbA1c reduction.","Weight management — trials reported weight reductions exceeding those of single GLP-1 agonists.","Obstructive sleep apnea — investigated as an endpoint in people with obesity.","Cardiometabolic markers — examined for effects on lipids, blood pressure, and hepatic fat.","Dual-agonism rationale — GIP is studied as complementary to GLP-1 for insulinotropic and satiety effects."],"faqs":[{"q":"What is tirzepatide?","a":"Tirzepatide is a dual GIP/GLP-1 receptor agonist approved for type 2 diabetes (Mounjaro) and chronic weight management (Zepbound)."},{"q":"How is tirzepatide different from semaglutide?","a":"Semaglutide activates the GLP-1 receptor alone; tirzepatide activates both GIP and GLP-1 receptors, a dual mechanism studied for greater metabolic effect."},{"q":"What does \"twincretin\" mean?","a":"It is an informal term for a peptide that engages two incretin pathways — here GIP and GLP-1 — within a single molecule."},{"q":"Is tirzepatide FDA approved?","a":"Yes, for type 2 diabetes and chronic weight management under the brand names Mounjaro and Zepbound. This page is a research and educational reference."}],"mechanism":"Co-activation of GIP + GLP-1 receptors; complementary insulinotropic and satiety effects.","molecularWeight":4813.5,"molecularFormula":"C225H348N48O68","sequence":null,"cas":"2023788-19-2","pubchemCid":166567236,"uniprotId":null,"fdaApproved":true,"url":"https://americanpeptide.com/catalog/tirzepatide"},{"slug":"insulin","name":"Insulin (human)","aliases":["Recombinant human insulin","rhInsulin","regular insulin","Humulin","Novolin"],"categories":["metabolic"],"categoryLabels":["Metabolic"],"researchAreas":["Type 1 diabetes","Type 2 diabetes","Glucose metabolism","Anabolic signaling"],"researchAreaGuides":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health","url":"https://americanpeptide.com/research-areas/weight-loss"}],"shortDescription":"The archetypal protein biologic — a 51-amino-acid two-chain hormone, disulfide-linked, and the first recombinant DNA drug ever marketed.","description":"Insulin is the hormone that defined the biologic era. It is a small but genuinely complex protein: two peptide chains — an A chain of 21 residues and a B chain of 30 — held together by two interchain disulfide bonds, with a third disulfide looping within the A chain. At ~5.8 kDa it is the smallest hormone in this catalog’s biologic tier, yet it is assembled, folded, and processed exactly like the larger proteins, and it was the molecule that proved recombinant human therapeutics were possible.","background":["Insulin is synthesized in the body as a single chain — preproinsulin → proinsulin — that folds and forms its disulfide bonds before a connecting C-peptide is excised, leaving the mature two-chain hormone. That biosynthetic detail is why early recombinant manufacturing expressed the A and B chains (or proinsulin) in bacteria and then handled folding and disulfide pairing as a controlled step: the chemistry that the body does enzymatically has to be reproduced and verified in a reactor. Get the disulfides wrong and you get a misfolded, inactive — or immunogenic — product.","Its history is foundational twice over. Insulin was discovered in 1921 in Toronto by Banting, Best, Macleod, and Collip, and the patent was famously sold to the university for one dollar on the principle that \"insulin belongs to the world.\" Six decades later, in 1982, recombinant human insulin (Humulin) became the first recombinant-DNA drug ever approved — the proof of concept for the entire modern biologic industry, including most of the engineered peptides elsewhere in this catalog.","And then the American drama. Despite the dollar patent and a century of manufacturing experience, US insulin list prices roughly tripled between 2002 and 2013, pushing some patients to ration a drug they cannot live without — a recurring, deadly access failure that sits uncomfortably against the molecule’s origin story. For a reference that takes provenance and honest pricing seriously, insulin is the clearest case study in the gap between what a medicine costs to make and what it is sold for.","Insulin is also widely misunderstood at the edges: it is occasionally misused in bodybuilding for its anabolic effects, where dosing errors cause life-threatening hypoglycemia, and the modern GLP-1 era has shifted public perception of what \"diabetes medicine\" even means. It remains, first and foremost, essential replacement therapy for type 1 diabetes and an important tool in advanced type 2."],"keyResearch":["Type 1 diabetes — life-sustaining replacement therapy; the body produces no insulin without it.","Type 2 diabetes — used when oral agents and incretins no longer maintain glycemic control.","Insulin-receptor signaling — the PI3K/AKT and MAPK pathways that make it a central anabolic and metabolic hormone.","Analog engineering — rapid-acting (lispro, aspart) and long-acting (glargine, detemir) analogs re-engineer the sequence/formulation to reshape the absorption curve.","First recombinant drug — Humulin (1982) established recombinant human protein manufacturing.","Hypoglycemia risk — narrow therapeutic margin; misuse outside medical supervision is dangerous."],"faqs":[{"q":"What is human insulin?","a":"A 51-amino-acid protein hormone made of two disulfide-linked chains that lowers blood glucose by driving its uptake into cells. Recombinant human insulin is produced in engineered bacteria or yeast and was the first recombinant-DNA drug approved (1982)."},{"q":"Why is insulin considered a biologic and not just a peptide?","a":"It is a folded, multi-chain protein whose activity depends on correct disulfide pairing, and it is produced in living cells. Its manufacturing and quality control are protein-grade, not the solid-phase synthesis used for short research peptides."},{"q":"Why is insulin so expensive in the US if the patent was sold for a dollar?","a":"The original patent was sold for $1, but modern insulin products, manufacturing, and the US pricing system are separate from that history. List prices rose sharply in the 2000s–2010s, a widely documented access problem."},{"q":"Is this medical advice?","a":"No. This is a research and educational reference. Insulin has a narrow safety margin and is a prescription medicine; nothing here is dosing guidance."}],"mechanism":"Binds the insulin receptor, a tyrosine kinase, triggering autophosphorylation and the PI3K/AKT cascade that drives GLUT4 translocation and glucose uptake into muscle and fat, suppresses hepatic glucose output, and promotes glycogen, lipid, and protein synthesis.","molecularWeight":5808,"molecularFormula":"C257H383N65O77S6","sequence":"A chain: GIVEQCCTSICSLYQLENYCN | B chain: FVNQHLCGSHLVEALYLVCGERGFFYTPKT","cas":"11061-68-0","pubchemCid":null,"uniprotId":null,"fdaApproved":true,"url":"https://americanpeptide.com/catalog/insulin"},{"slug":"glucagon","name":"Glucagon","aliases":["GlucaGen","Baqsimi","Gvoke"],"categories":["metabolic"],"categoryLabels":["Metabolic"],"researchAreas":["Severe hypoglycemia","Glucose counter-regulation","Triple-agonist metabolic drugs"],"researchAreaGuides":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health","url":"https://americanpeptide.com/research-areas/weight-loss"}],"shortDescription":"Insulin’s counter-hormone — a 29-amino-acid peptide that raises blood glucose, the emergency rescue for severe lows, and the \"G\" in the new triple agonists.","description":"Glucagon is the metabolic mirror image of insulin. Released by the pancreatic alpha cells when blood sugar falls, this 29-amino-acid peptide tells the liver to break down glycogen and make new glucose, pushing blood sugar back up. It is the body’s primary defense against hypoglycemia, the basis of emergency rescue products, and — in a development that has put it back at the center of metabolic drug design — one of the three receptors the newest weight-loss agonists deliberately engage.","background":["Glucagon and insulin are a push-pull pair: insulin lowers blood glucose, glucagon raises it, and health depends on their balance. When blood sugar drops dangerously — most often in insulin-treated diabetes — glucagon is the rescue, which is why it is sold as emergency kits: the classic reconstituted injection (GlucaGen), a nasal powder (Baqsimi, 2019), and a ready-to-use autoinjector (Gvoke). It is also used in radiology and endoscopy to relax smooth muscle.","As a molecule it is a 29-residue peptide derived from the same precursor (preproglucagon) that gives rise to GLP-1 and GLP-2 — a family relationship that matters more than it first appears. For decades glucagon was framed only as the hormone you suppress in diabetes. The reframing came from drug design: adding glucagon-receptor agonism to incretin drugs increases energy expenditure and fat mobilization, and the glucagon receptor is the \"G\" in the GIP/GLP-1/glucagon triple agonists (such as retatrutide) now posting the largest weight-loss numbers in trials.","That is the forward-looking turn — the same hormone that, unopposed, worsens diabetic hyperglycemia becomes, when balanced against incretin signaling, a lever for greater fat loss and metabolic rate. It is a clean example of how a \"bad\" hormone in one context is a deliberate design ingredient in another."],"keyResearch":["Severe hypoglycemia rescue — the approved use; raises blood glucose fast via hepatic glycogenolysis.","Insulin counter-regulation — the opposing arm of moment-to-moment glucose control.","Triple-agonist drugs — glucagon-receptor agonism is the \"G\" in GIP/GLP-1/glucagon agonists studied for large weight loss.","Procedural use — relaxes GI smooth muscle for imaging and endoscopy.","Preproglucagon family — shares a precursor with GLP-1 and GLP-2."],"faqs":[{"q":"What does glucagon do?","a":"Glucagon raises blood sugar — it is the counter-hormone to insulin. The pancreas releases it when glucose falls, signaling the liver to release stored glucose. As a drug it is the emergency rescue for severe hypoglycemia."},{"q":"Why is glucagon in weight-loss drugs?","a":"Glucagon-receptor agonism increases energy expenditure and fat mobilization. It is the \"G\" in the GIP/GLP-1/glucagon triple agonists (like retatrutide) that show the largest weight-loss effects in trials."},{"q":"How is it related to GLP-1?","a":"Both come from the same precursor protein, preproglucagon. Glucagon raises blood sugar; GLP-1 lowers it and curbs appetite — different products of one parent molecule."},{"q":"Is this medical advice?","a":"No — this is a research and educational reference, not dosing guidance."}],"mechanism":"Binds the glucagon receptor on hepatocytes, raising cAMP and driving glycogenolysis and gluconeogenesis to increase blood glucose. It opposes insulin in the moment-to-moment regulation of blood sugar.","molecularWeight":3485,"molecularFormula":"C153H225N43O49S","sequence":"HSQGTFTSDYSKYLDSRRAQDFVQWLMNT","cas":"16941-32-5","pubchemCid":null,"uniprotId":null,"fdaApproved":true,"url":"https://americanpeptide.com/catalog/glucagon"},{"slug":"tesamorelin","name":"Tesamorelin","aliases":["Egrifta"],"categories":["growth-hormone","metabolic"],"categoryLabels":["Growth Hormone","Metabolic"],"researchAreas":["Visceral adiposity","HIV-associated lipodystrophy","Cognition"],"researchAreaGuides":[{"slug":"weight-loss","label":"Weight Loss & Metabolic Health","url":"https://americanpeptide.com/research-areas/weight-loss"},{"slug":"cognition-neuroprotection","label":"Cognition & Neuroprotection","url":"https://americanpeptide.com/research-areas/cognition-neuroprotection"}],"shortDescription":"GHRH analog FDA-approved for HIV-associated lipodystrophy.","description":"Tesamorelin is a stabilized 44-amino-acid GHRH analog approved by the FDA in 2010 for reduction of excess abdominal fat in HIV-infected patients with lipodystrophy.","background":["Tesamorelin is a stabilized 44-amino-acid analog of growth-hormone-releasing hormone (GHRH). By stimulating the pituitary to release endogenous GH, it preserves more of the body’s natural feedback than exogenous GH would.","It is FDA-approved (Egrifta, 2010) specifically to reduce excess visceral abdominal fat in people with HIV-associated lipodystrophy. Beyond that indication it has been studied for visceral adiposity more broadly and, in research settings, for effects on cognition."],"keyResearch":["Visceral fat reduction — the approved use, lowering excess abdominal fat in HIV-associated lipodystrophy.","GH axis — GHRH-receptor agonism raising endogenous GH and IGF-1.","Cognition — examined in research for effects related to GH signaling.","Hepatic fat — studied as a metabolic endpoint.","FDA-approved (Egrifta) — for a specific HIV-related indication."],"faqs":[{"q":"What is tesamorelin?","a":"Tesamorelin is a GHRH analog FDA-approved (Egrifta) to reduce excess abdominal fat in people with HIV-associated lipodystrophy."},{"q":"How does it work?","a":"It stimulates the pituitary to release the body’s own growth hormone, rather than supplying GH directly."},{"q":"What is it approved for?","a":"Reduction of excess visceral abdominal fat in HIV-associated lipodystrophy. Other uses described here are research contexts, not approved indications."},{"q":"Is this medical advice?","a":"No — this page is a research and educational reference, not medical advice or a dosing protocol."}],"mechanism":"GHRH receptor agonism → endogenous GH release.","molecularWeight":5135.9,"molecularFormula":"C221H366N72O67S","sequence":null,"cas":"218949-48-5","pubchemCid":16137828,"uniprotId":null,"fdaApproved":true,"url":"https://americanpeptide.com/catalog/tesamorelin"}]}